Proteintech, 30212-1-AP, BRAWNIN Polyclonal antibody

Size: 20ul / 150ul The BRAWNIN (30212-1-AP) by Proteintech is a Polyclonal antibody targeting BRAWNIN in WB, IF/ICC, ELISA applications with reactivity to Human samples 30212-1-AP targets BRAWNIN in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells Positive IF/ICC detected in: U-251 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:400-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Ubiquinol-cytochrome-c reductase complex assembly factor 6 (UQCC6) is also named as BRAWNIN, BR and C12orf73, and belongs to the UQCC6 family. BRAWNIN (BR), a 71 a.a. peptide encoded by C12orf73, is essential for respiratory chain complex III (CIII) assembly. In human cells, BRAWNIN is induced by the energy-sensing AMPK pathway, and its depletion impairs mitochondrial ATP production. In zebrafish, Brawnin deletion causes complete CIII loss, resulting in severe growth retardation, lactic acidosis and early death (PMID:32161263).  BR is also detectable in human cardiac and skeletal muscle where it displays a staining pattern characteristic of the mitochondria network. BR protein abundance in mouse tissues correlated well with that of mitochondrial respiratory chain proteins, being high in brown adipose, cardiac and skeletal muscle but virtually undetectable in white adipose tissue (PMID:32161263). BR resides in the IMM and not in the outer mitochondrial membrane (OMM) (PMID:32161263). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32955 Product name: Recombinant human BRAWNIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-71 aa of Sequence: EVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEELK Predict reactive species Full Name: chromosome 12 open reading frame 73 Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 9 kDa Gene Symbol: C12orf73 Gene ID (NCBI): 728568 RRID: AB_3086265 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q69YU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.