Proteintech, 30223-1-AP, CD59 Polyclonal antibody

Size: 20ul / 150ul The CD59 (30223-1-AP) by Proteintech is a Polyclonal antibody targeting CD59 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30223-1-AP targets CD59 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, HT-1080 cells, HT-29 cells, HUVEC cells, U-87 MG cells Positive IHC detected in: human placenta tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32557 Product name: Recombinant human CD59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-102 aa of BC001506 Sequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN Predict reactive species Full Name: CD59 molecule, complement regulatory protein Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC001506 Gene Symbol: CD59 Gene ID (NCBI): 966 RRID: AB_3086267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13987 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.