Iright
BRAND / VENDOR: Proteintech

Proteintech, 30227-1-AP, WDR43 Polyclonal antibody

CATALOG NUMBER: 30227-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WDR43 (30227-1-AP) by Proteintech is a Polyclonal antibody targeting WDR43 in WB, IHC, ELISA applications with reactivity to human samples 30227-1-AP targets WDR43 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HepG2 cells, Jurkat cells Positive IHC detected in: mouse lung tissue, mouse ovary tissue, rat liver tissue, rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information WDR43, a WD40 domain-containing protein, is a conserved component of the small-subunit processome (SSUP), which mediates pre-18S ribosomal RNA (rRNA) transcription and processing in the nucleolus and is critical for ribosome biogenesis in yeast. Its mutation in zebrafish causes a variety of early developmental defects in specific tissues. WDR43 directly promotes ESC self-renewal by maintaining high-level expression of its target genes involved in pluripotency programs. (PMID: 28880863, 24497835, 31128943) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30585 Product name: Recombinant human WDR43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of NM_015131 Sequence: MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGCLYSCSDDKHI Predict reactive species Full Name: WD repeat domain 43 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_015131 Gene Symbol: WDR43 Gene ID (NCBI): 23160 RRID: AB_3086268 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924