Product Description
Size: 20ul / 150ul
The IGFBP7 (30228-1-AP) by Proteintech is a Polyclonal antibody targeting IGFBP7 in WB, ELISA applications with reactivity to Human, mouse samples
30228-1-AP targets IGFBP7 in WB, ELISA applications and shows reactivity with Human, mouse samples.
Tested Applications
Positive WB detected in: mouse spleen tissue, mouse kidney tissue, mouse ovary tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Specification
Tested Reactivity: Human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33040 Product name: Recombinant human IGFBP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-282 aa of BC066339 Sequence: CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL Predict reactive species
Full Name: insulin-like growth factor binding protein 7
Calculated Molecular Weight: 29 kDa
Observed Molecular Weight: 32 kDa
GenBank Accession Number: BC066339
Gene Symbol: IGFBP7
Gene ID (NCBI): 3490
RRID: AB_3086269
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q16270
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924