Proteintech, 30228-1-AP, IGFBP7 Polyclonal antibody

Size: 20ul / 150ul The IGFBP7 (30228-1-AP) by Proteintech is a Polyclonal antibody targeting IGFBP7 in WB, ELISA applications with reactivity to Human, mouse samples 30228-1-AP targets IGFBP7 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse kidney tissue, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33040 Product name: Recombinant human IGFBP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-282 aa of BC066339 Sequence: CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL Predict reactive species Full Name: insulin-like growth factor binding protein 7 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC066339 Gene Symbol: IGFBP7 Gene ID (NCBI): 3490 RRID: AB_3086269 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.