Proteintech, 30232-1-AP, SLC7A2 Polyclonal antibody

Size: 20ul / 150ul The SLC7A2 (30232-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30232-1-AP targets SLC7A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Solute carrier family 7 member 2 (SLC7A2), also known as CAT2, is a member of the solute carrier superfamily. It functions as a cationic amino acid transporter, which can transport cationic amino acids (arginine, lysine and ornithine) into the cytosol and regulate inflammation (PMID: 35152203). It has been shown that lower SLC7A2 expression is associated with worse prognosis of ovarian cancer and hepatocellular carcinoma (PMID: 34108444; 32647070), and SLC7A2 deficiency in inflammatory bowel tissues increases the risk of inflammation-associated colon tumorigenesis (PMID: 30202097) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31207 Product name: Recombinant human SLC7A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 568-657 aa of BC104905 Sequence: ILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF Predict reactive species Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 Calculated Molecular Weight: 698 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC104905 Gene Symbol: SLC7A2 Gene ID (NCBI): 6542 RRID: AB_3086271 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52569 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.