Proteintech, 30243-1-AP, YIPF6 Polyclonal antibody

Size: 20ul / 150ul The YIPF6 (30243-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF6 in WB, ELISA applications with reactivity to human, mouse samples 30243-1-AP targets YIPF6 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information YIPF6 encodes a Golgi- and ER-localized membrane protein that regulates vesicle trafficking and secretory pathway integrity through interaction with Rab GTPases. Highly expressed in intestinal epithelium and immune tissues, YIPF6 is essential for Paneth and goblet cell granule maturation and mucosal immune homeostasis. Loss of YIPF6 disrupts epithelial secretion and predisposes to inflammatory bowel-like disease, establishing it as a critical regulator of Golgi function and gut barrier defense. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32477 Product name: Recombinant human YIPF6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-84 aa of BC012469 Sequence: AEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNT Predict reactive species Full Name: Yip1 domain family, member 6 Calculated Molecular Weight: 236 aa, 26 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC012469 Gene Symbol: YIPF6 Gene ID (NCBI): 286451 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EC8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.