Proteintech, 30245-1-AP, DCBLD2 Polyclonal antibody

Size: 20ul / 150ul The DCBLD2 (30245-1-AP) by Proteintech is a Polyclonal antibody targeting DCBLD2 in WB, IHC, ELISA applications with reactivity to human samples 30245-1-AP targets DCBLD2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, U2OS cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information DCBLD2, also known as ESDN or CLCP1, was first identified from human coronary arterial cells by a signal sequence trap method. DCBLD2 regulates proliferation, migration, and invasion in various tumors, including glioma, hypopharyngeal squamous cell carcinoma, and myxofibrosarcoma. The human DCBLD2 protein has a predicted molecular mass of ∼80 kDa based on its amino acid sequence, although it regularly displays an effective molecular mass of ∼130 kDa via SDS-PAGE (PMID: 30902898). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32823 Product name: Recombinant human DCBLD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 582-743 aa of BC029658 Sequence: LQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL Predict reactive species Full Name: discoidin, CUB and LCCL domain containing 2 Calculated Molecular Weight: 775 aa, 89 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC029658 Gene Symbol: DCBLD2 Gene ID (NCBI): 131566 RRID: AB_3086277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.