Iright
BRAND / VENDOR: Proteintech

Proteintech, 30247-1-AP, C1orf54 Polyclonal antibody

CATALOG NUMBER: 30247-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C1orf54 (30247-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf54 in IHC, IF-P, ELISA applications with reactivity to Human, mouse samples 30247-1-AP targets C1orf54 in IHC, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information C1orf54 is a newly identified protein encoded by an open reading frame on chromosome 1. C1orf54 is highly expressed in healthy mouse kidneys and is only expressed in tubular epithelial cells (TECs), not in glomeruli(PMID: 29999589). C1orf54 promotes renal repair and TEC proliferation through PI3K/AKT signalling, which alleviates kidney damage after ischaemia‐reperfusion injury (IRI) (PMID: 29999589). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32876 Product name: Recombinant human C1orf54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-131 aa of BC017761 Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM Predict reactive species Full Name: chromosome 1 open reading frame 54 GenBank Accession Number: BC017761 Gene Symbol: C1orf54 Gene ID (NCBI): 79630 RRID: AB_3086279 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924