Proteintech, 30256-1-AP, DUSP5 Polyclonal antibody

Size: 20ul / 150ul The DUSP5 (30256-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP5 in WB, IP, ELISA applications with reactivity to human samples 30256-1-AP targets DUSP5 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HCT 116 cells Positive IP detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information DUSP5 (Dual specificity protein phosphatase 5) is also named as VH3. DUSP5, a member of DUSPs superfamily, is located in the nucleus and plays crucially regulatory roles in the signaling pathway transduction (PMID: 34169608). DUSP5 promotes the osteogenic differentiation of mesenchymal stromal cells (MSCs) by repressing SMAD1 signaling pathway in a SCP1/2‐dependent manner (PMID: 34169608). DUSP5, which specifically dephosphorylates extracellular signal-regulated kinase (ERK1/2), blocks pulmonary vascular smooth muscle cell proliferation (PMID: 34142888). DUSP5, an ERK1/2-specific endogenous phosphatase, was expressed at low levels in CRC (PMID: 36526622). DUSP5, a member of the DUSP subfamily, is known to regulate cellular inflammation (PMID: 33361528). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32997 Product name: Recombinant human DUSP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-384 aa of NM_004419 Sequence: LQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC Predict reactive species Full Name: dual specificity phosphatase 5 Calculated Molecular Weight: 42kd Observed Molecular Weight: 42 kDa GenBank Accession Number: NM_004419 Gene Symbol: DUSP5 Gene ID (NCBI): 1847 RRID: AB_3669707 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16690 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.