Iright
BRAND / VENDOR: Proteintech

Proteintech, 30257-1-AP, SCML1 Polyclonal antibody

CATALOG NUMBER: 30257-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SCML1 (30257-1-AP) by Proteintech is a Polyclonal antibody targeting SCML1 in WB, ELISA applications with reactivity to Human samples 30257-1-AP targets SCML1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Sex comb on midleg-like 1 (SCML1) is a meiosis-specific protein and is an essential component of the meiotic dense body. SCML1 is preferentially expressed in germ stem cells of testis, therefore likely involved in spermatogenesis. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33003 Product name: Recombinant human SCML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-260 aa of BC026159 Sequence: MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEI Predict reactive species Full Name: sex comb on midleg-like 1 (Drosophila) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC026159 Gene Symbol: SCML1 Gene ID (NCBI): 6322 RRID: AB_2935536 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924