Proteintech, 30283-1-AP, PSMB7 Polyclonal antibody

Size: 20ul / 150ul The PSMB7 (30283-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB7 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30283-1-AP targets PSMB7 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, HepG2 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. PSMB7 protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Expression of this catalytic subunit is downregulated by gamma interferon, and proteolytic processing is required to generate a mature subunit. Component of the 20S core proteasome complex are involved in the proteolytic degradation of most intracellular proteins. PSMB7 displays a trypsin-like activity.(PMID:15244466, PMID:27176742, PMID: 8610016) Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32201 Product name: Recombinant human PSMB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-277 aa of BC000509 Sequence: TAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 7 Calculated Molecular Weight: 29.9 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC000509 Gene Symbol: PSMB7 Gene ID (NCBI): 5695 RRID: AB_3086285 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.