Iright
BRAND / VENDOR: Proteintech

Proteintech, 30291-1-AP, VAV3 Polyclonal antibody

CATALOG NUMBER: 30291-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VAV3 (30291-1-AP) by Proteintech is a Polyclonal antibody targeting VAV3 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 30291-1-AP targets VAV3 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, THP-1 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer tissue, human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells, HeLa cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Vav3, a member of Dbl family which is also the activator of GTP kinase of Rho family, can activate the expression of RhoA, Racl and Cdc42 (PMID:28285969). Vav3 is associated with tumor growth, apoptosis, invasion, metastasis and angiogenesis (PMID:28285969). Vav3 is a multiple function protein with both signaling molecule and coactivator activities. Vav3 oncogene is overexpressed in androgen-independent prostate cancer cells relative to their androgen-dependent counterparts and contribute to development of hormone refractory prostate cancer (PMID:21455584). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33022 Product name: Recombinant human VAV3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-847 aa of NM_006113 Sequence: KCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE Predict reactive species Full Name: vav 3 guanine nucleotide exchange factor Calculated Molecular Weight: 98kd Observed Molecular Weight: 98 kDa GenBank Accession Number: NM_006113 Gene Symbol: VAV3 Gene ID (NCBI): 10451 RRID: AB_3086288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924