Product Description
Size: 20ul / 150ul
The p38 MAPK (30382-1-AP) by Proteintech is a Polyclonal antibody targeting p38 MAPK in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
30382-1-AP targets p38 MAPK in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, NIH/3T3 cells, PC-12 cells
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33174 Product name: Recombinant human p38 MAPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-360 aa of BC031574 Sequence: GTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES Predict reactive species
Full Name: mitogen-activated protein kinase 14
Calculated Molecular Weight: 360 aa, 41 kDa
Observed Molecular Weight: 38-42 kDa
GenBank Accession Number: BC031574
Gene Symbol: p38 MAPK
Gene ID (NCBI): 1432
RRID: AB_3669717
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q16539
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924