Proteintech, 30391-1-AP, SYNJ2 Polyclonal antibody

Size: 20ul / 150ul The SYNJ2 (30391-1-AP) by Proteintech is a Polyclonal antibody targeting SYNJ2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30391-1-AP targets SYNJ2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SYNJ2(Synaptojanin-2) is also named as KIAA0348 and belongs to the synaptojanin family. SYNJ2 encodes an inositol polyphosphate phosphatase that functions in recycling neurotransmitter vesicles and is implicated in spermatogenesis(PMID: 24103750). This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33002 Product name: Recombinant human SYNJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 678-839 aa of BC043277 Sequence: RRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHGHKTLGHWVTISDQEKRTALQVFDPLAKT Predict reactive species Full Name: synaptojanin 2 Calculated Molecular Weight: 1496 aa, 166 kDa Observed Molecular Weight: 143 kDa, 160 kDa GenBank Accession Number: BC043277 Gene Symbol: SYNJ2 Gene ID (NCBI): 8871 RRID: AB_3086305 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15056 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.