Proteintech, 30393-1-AP, TMED5 Polyclonal antibody

Size: 20ul / 150ul The TMED5 (30393-1-AP) by Proteintech is a Polyclonal antibody targeting TMED5 in WB, ELISA applications with reactivity to human, mouse, rat samples 30393-1-AP targets TMED5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MKN-45 cells, NCI-H1299 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TMED5 ( transmembrane p24 trafficking protein 5) is highly expressed in cervical and bladder cancer cell lines. TMED5 promotes nuclear autophagy and the malignant behavior of cervical cancer cells (PMID:36530030). Moreover, TMED5 could interact with WNT7B and thus activate the canonical WNT-CTNNB1/β-catenin signaling pathway (PMID:30394198). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33253 Product name: Recombinant human TMED5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-178 aa of BC070051 Sequence: IFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQILLR Predict reactive species Full Name: transmembrane emp24 protein transport domain containing 5 Observed Molecular Weight: 25 kDa GenBank Accession Number: BC070051 Gene Symbol: TMED5 Gene ID (NCBI): 50999 RRID: AB_3086307 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.