Proteintech, 30425-1-AP, PFKFB2 Polyclonal antibody

Size: 20ul / 150ul The PFKFB2 (30425-1-AP) by Proteintech is a Polyclonal antibody targeting PFKFB2 in WB, ELISA applications with reactivity to Human samples 30425-1-AP targets PFKFB2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32347 Product name: Recombinant human PFKFB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-505 aa of BC075076 Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Predict reactive species Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 Calculated Molecular Weight: 505 aa, 58 kDa Observed Molecular Weight: 50-58 kDa GenBank Accession Number: BC075076 Gene Symbol: PFKFB2 Gene ID (NCBI): 5208 RRID: AB_3086311 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60825 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.