Iright
BRAND / VENDOR: Proteintech

Proteintech, 30428-1-AP, CTCF Polyclonal antibody

CATALOG NUMBER: 30428-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CTCF (30428-1-AP) by Proteintech is a Polyclonal antibody targeting CTCF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to Human, mouse samples 30428-1-AP targets CTCF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, RAW 264.7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:800-1:3200 Background Information Transcriptional insulators are DNA elements that set boundaries on the actions of enhancer and silencer elements and thereby organize the eukaryotic genome into regulatory domains. All vertebrate insulators appear to use the versatile CTCF protein. CTCF uses various combinations of its 11 zinc fingers to recognize a variety of unrelated DNA sequences. Once bound to DNA, CTCF can function as a transcriptional insulator, repressor, or activator, depending on the context of the binding site [PMID:12787766,15454938]. In vertebrates, this 11 zinc-finger protein is shown to be crucial in processes of epigenetic imprinting, X chromosome inactivation , and associated with various complex human diseases including cancer and diabetes [PMID:23139640]. The calcualted molecular weight of CTCF is 83 kDa, but stimulation of human corneal epithelial cells with hypoxic stress suppressed a high molecular mass form of CTCF (150 kDa), but not a lower molecular weight form of CTCF (130 kDa)(PMID: 22354964), and there are multiple isoforms of CTCF with molecular masses of 55, 70, 73, 80, 97, and 130 kDa have been observed (PMID: 12878173). Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32417 Product name: Recombinant human CTCF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 562-727 aa of BC014267 Sequence: KTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR Predict reactive species Full Name: CCCTC-binding factor (zinc finger protein) Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 110-150 kDa GenBank Accession Number: BC014267 Gene Symbol: CTCF Gene ID (NCBI): 10664 RRID: AB_3086312 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49711 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924