Proteintech, 30441-1-AP, INCA1 Polyclonal antibody

Size: 20ul / 150ul The INCA1 (30441-1-AP) by Proteintech is a Polyclonal antibody targeting INCA1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 30441-1-AP targets INCA1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27997 Product name: Recombinant human INCA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-236 aa of BC119781 Sequence: MLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE Predict reactive species Full Name: inhibitor of CDK interacting with cyclin A1 Calculated Molecular Weight: 236 aa, 27 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC119781 Gene Symbol: INCA1 Gene ID (NCBI): 388324 RRID: AB_3086316 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q0VD86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.