Proteintech, 30466-1-AP, SLC16A13 Polyclonal antibody

Size: 20ul / 150ul The SLC16A13 (30466-1-AP) by Proteintech is a Polyclonal antibody targeting SLC16A13 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30466-1-AP targets SLC16A13 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC16A13 (solute carrier family 16 member 13), which encodes the monocarboxylate transporter 13 (MCT13), is a susceptibility gene for type 2 diabetes and is expressed in the liver and duodenum (PMID: 37630718). SLC16A13 is a potential target for the treatment of type 2 diabetes and non-alcoholic fatty liver disease (PMID: 34211098). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33183 Product name: Recombinant human SLC16A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 395-426 aa of BC142618 Sequence: FCFSTTTSGPQDLVTEALDTKVPLPKEGLEED Predict reactive species Full Name: solute carrier family 16, member 13 (monocarboxylic acid transporter 13) Calculated Molecular Weight: 426 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC142618 Gene Symbol: SLC16A13 Gene ID (NCBI): 201232 RRID: AB_3086327 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7RTY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.