Iright
BRAND / VENDOR: Proteintech

Proteintech, 30467-1-AP, ANKIB1 Polyclonal antibody

CATALOG NUMBER: 30467-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ANKIB1 (30467-1-AP) by Proteintech is a Polyclonal antibody targeting ANKIB1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to Human, mouse samples 30467-1-AP targets ANKIB1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissue, mouse placenta tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Ankyrin repeat and IBR domain-containing protein 1 (ANKIB1) is also named as KIAA1386, and belongs to the RBR family. ANKIB1 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. The common biomarkers found within the H and EC region of brain are ZNF621, SLC25A46, RAE1, and ANKIB1. Among these biomarkers, RAE1, ANKIB1, and SLC25A46 have been reported to be prominently involved in several neurodegenerative disorders (PMID:33878365). ANKIB1 is also found to be associated with Cerebral cavernous malformations (PMID:20798775). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33126 Product name: Recombinant human ANKIB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 870-1089 aa of NM_019004.1 Sequence: ALDEETRDFLSNEASLGAIGTSLPSRLDSVPRNTDSPRAALSSSELLELGDSLMRLGAENDPFSTDTLSSHPLSEARSDFCPSSSDPDSAGQDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQVHLV Predict reactive species Full Name: ankyrin repeat and IBR domain containing 1 Calculated Molecular Weight: 122 kDa Observed Molecular Weight: 122 kDa GenBank Accession Number: NM_019004.1 Gene Symbol: ANKIB1 Gene ID (NCBI): 54467 RRID: AB_3086328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2G1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924