Proteintech, 30468-1-AP, MTMR9 Polyclonal antibody

Size: 20ul / 150ul The MTMR9 (30468-1-AP) by Proteintech is a Polyclonal antibody targeting MTMR9 in WB, ELISA applications with reactivity to Human samples 30468-1-AP targets MTMR9 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33501 Product name: Recombinant human MTMR9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 165-393 aa of BC022003 Sequence: PKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRCALSAYCNTKQKWE Predict reactive species Full Name: myotubularin related protein 9 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 60-63 kDa GenBank Accession Number: BC022003 Gene Symbol: MTMR9 Gene ID (NCBI): 66036 RRID: AB_3669724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.