Proteintech, 30469-1-AP, GSDMC Polyclonal antibody

Size: 20ul / 150ul The GSDMC (30469-1-AP) by Proteintech is a Polyclonal antibody targeting GSDMC in WB, IHC, ELISA applications with reactivity to human samples 30469-1-AP targets GSDMC in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, HCT 116 cells, A375 cells Positive IHC detected in: Human bowens diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Gasdermin (GSDM) superfamily consists of Gasdermin family genes (GSDMA, GSDMB, GSDMC and GSDMD in humans) and Gasdermin-related genes (DFNA5, DFNB59 in humans). GSDM family members were shown to be detected in the epithelium of various tissue types in a highly tissue-specific manner and suggested to have differentiation-status specific roles. Gasdermin C (GSDMC) was known as melanoma-derived leucine zipper-containing extranuclear factor (MLZE). Several studies have suggested that GSDMC may be involved in the course of tumorigenesis such as acquisition of metastatic potential in melanoma cells or promotion of cell proliferation in colorectal carcinogenesis and that GSDMC may function as an oncogene. (PMID: 29428815) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33319 Product name: Recombinant human GSDMC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-508 aa of NM_031415 Sequence: VHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA Predict reactive species Full Name: gasdermin C Calculated Molecular Weight: 58kd Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_031415 Gene Symbol: GSDMC Gene ID (NCBI): 56169 RRID: AB_3086329 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.