Proteintech, 30478-1-AP, B4GALT4 Polyclonal antibody

Size: 20ul / 150ul The B4GALT4 (30478-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALT4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30478-1-AP targets B4GALT4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, mouse kidney tissue, mouse lung tissue, mouse thymus tissue, rat kidney tissue, rat thymus tissue, mouse cerebellum tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32337 Product name: Recombinant human B4GALT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-142 aa of BC004523 Sequence: QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLE Predict reactive species Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 34-40 kDa GenBank Accession Number: BC004523 Gene Symbol: B4GALT4 Gene ID (NCBI): 8702 RRID: AB_3086331 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60513 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.