Proteintech, 30480-1-AP, CISD3 Polyclonal antibody

Size: 20ul / 150ul The CISD3 (30480-1-AP) by Proteintech is a Polyclonal antibody targeting CISD3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30480-1-AP targets CISD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat liver tissue, mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32754 Product name: Recombinant human CISD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-127 aa of NM_001136498.1 Sequence: ARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL Predict reactive species Full Name: CDGSH iron sulfur domain 3 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: NM_001136498.1 Gene Symbol: CISD3 Gene ID (NCBI): 284106 RRID: AB_3086332 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0C7P0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.