Iright
BRAND / VENDOR: Proteintech

Proteintech, 30481-1-AP, C19orf48 Polyclonal antibody

CATALOG NUMBER: 30481-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C19orf48 (30481-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf48 in WB, ELISA applications with reactivity to Human samples 30481-1-AP targets C19orf48 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Chromosome 19 open reading frame 48 (C19orf48) plays a crucial role in the development of breast cancer and the overexpression of C19orf48 correlates with poor prognosis in breast cancer. C19orf48 may act as a useful and predictive biomarker for the prognosis of breast cancer. (PMID: 38223642) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32888 Product name: Recombinant human C19orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-58 aa of BC006151 Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR Predict reactive species Full Name: chromosome 19 open reading frame 48 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 12-13 kDa GenBank Accession Number: BC006151 Gene Symbol: C19orf48 Gene ID (NCBI): 84798 RRID: AB_3669725 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6RUI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924