Iright
BRAND / VENDOR: Proteintech

Proteintech, 30490-1-AP, NRXN2 Polyclonal antibody

CATALOG NUMBER: 30490-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NRXN2 (30490-1-AP) by Proteintech is a Polyclonal antibody targeting NRXN2 in IF-P, ELISA applications with reactivity to human, rat samples 30490-1-AP targets NRXN2 in IF-P, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IF-P detected in: rat brain tissue Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The three members of the human neurexin gene family, neurexin 1 (NRXN1), neurexin 2 (NRXN2), and neurexin 3 (NRXN3), encode neuronal adhesion proteins that have important roles in synapse development and function (PMID: 22209245). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32646 Product name: Recombinant human NRXN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1480-1636 aa of NM_015080 Sequence: ERDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGERGPPGAVEVIRESSSTT Predict reactive species Full Name: neurexin 2 Calculated Molecular Weight: 185KD GenBank Accession Number: NM_015080 Gene Symbol: NRXN2 Gene ID (NCBI): 9379 RRID: AB_3669727 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924