Proteintech, 30510-1-AP, SEC23B Polyclonal antibody

Size: 20ul / 150ul The SEC23B (30510-1-AP) by Proteintech is a Polyclonal antibody targeting SEC23B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30510-1-AP targets SEC23B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells, Raji cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33302 Product name: Recombinant human SEC23B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC005404 Sequence: MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPA Predict reactive species Full Name: Sec23 homolog B (S. cerevisiae) Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 80-86 kDa GenBank Accession Number: BC005404 Gene Symbol: SEC23B Gene ID (NCBI): 10483 RRID: AB_3086343 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15437 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.