Proteintech, 30512-1-AP, SNX29 Polyclonal antibody

Size: 20ul / 150ul The SNX29 (30512-1-AP) by Proteintech is a Polyclonal antibody targeting SNX29 in WB, ELISA applications with reactivity to human samples 30512-1-AP targets SNX29 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX29 (Sorting nexin 29) is associated with bipolar disorder (BPD) and major depressive disorder (MDD) in the Han population (PMID: 33143498). The expression of SNX29 is significantly upregulated in most tumor tissues, and its expression is associated with the progression, immune infiltration and drug sensitivity of various cancers (PMID: 36829159). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32567 Product name: Recombinant human SNX29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of XM_011522738 Sequence: MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRCRLSTFYEDWS Predict reactive species Full Name: sorting nexin 29 Calculated Molecular Weight: 91kd Observed Molecular Weight: 100-110 kDa GenBank Accession Number: XM_011522738 Gene Symbol: SNX29 Gene ID (NCBI): 92017 RRID: AB_3669729 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.