Iright
BRAND / VENDOR: Proteintech

Proteintech, 30516-1-AP, STAP2 Polyclonal antibody

CATALOG NUMBER: 30516-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STAP2 (30516-1-AP) by Proteintech is a Polyclonal antibody targeting STAP2 in WB, ELISA applications with reactivity to human samples 30516-1-AP targets STAP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information STAP2, also known as BKS, belongs to the signal-transducing adaptor protein (STAP) family, The family includes STAP1 and STAP2, is a group of adaptor molecules involved in regulating multiple signaling pathways. The expression level of STAP2 in tubular cells is significantly higher than that in other renal cells, accounting for approximately 70%. In tubular epithelial cells, which are primarily affected by renal injury, STAP2 is mainly localized in the cytoplasm (PMID: 39533293). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28818 Product name: Recombinant human STAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-403 aa of BC000795 Sequence: VRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH Predict reactive species Full Name: signal transducing adaptor family member 2 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC000795 Gene Symbol: STAP2 Gene ID (NCBI): 55620 RRID: AB_3086344 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924