Proteintech, 30517-1-AP, AK6 Polyclonal antibody

Size: 20ul / 150ul The AK6 (30517-1-AP) by Proteintech is a Polyclonal antibody targeting AK6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30517-1-AP targets AK6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Adenylate Kinase 6 (AK6), also known as human coilin-interacting nuclear ATPase protein (hCINAP), is a unique enzyme that belongs to the adenylate kinase family. It is encoded by the AK6 gene located on chromosome 5q13.2. AK6 is a dual-activity enzyme, possessing both adenylate kinase and ATPase activities. The protein is involved in various biological processes, including gene transcription, ribosome quality control, embryonic development, cellular senescence, metabolism, proliferation, apoptosis, DNA damage response, and inflammation. It is also implicated in tumor development and has been explored as a potential drug target for cancer and neurodegenerative diseases. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29330 Product name: Recombinant human AK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of NM_016283.4 Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS Predict reactive species Full Name: AK6 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20-24 kDa GenBank Accession Number: NM_016283.4 Gene Symbol: AK6 Gene ID (NCBI): 102157402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3D8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.