Proteintech, 30518-1-AP, WNT8A Polyclonal antibody

Size: 20ul / 150ul The WNT8A (30518-1-AP) by Proteintech is a Polyclonal antibody targeting WNT8A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 30518-1-AP targets WNT8A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, HT-29 cells, SW480 cells, rat heart tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information WNT8A,also named as WNT8D, belongs to the Wnt family of secreted signaling proteins. It is a ligand for members of the frizzled family of seven transmembrane receptors. These have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT8A may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29510 Product name: Recombinant human WNT8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-271 aa of NM_001300938 Sequence: LAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTE Predict reactive species Full Name: wingless-type MMTV integration site family, member 8A Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39-45 kDa GenBank Accession Number: NM_001300938 Gene Symbol: WNT8A Gene ID (NCBI): 7478 RRID: AB_3086345 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1J5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.