Proteintech, 30520-1-AP, Claudin 9 Polyclonal antibody

Size: 20ul / 150ul The Claudin 9 (30520-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30520-1-AP targets Claudin 9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells Positive IHC detected in: human endometrial cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: T-47D cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium.They are small (20-27kDa) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. This antibody is specifically against claudin 9. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29607 Product name: Recombinant human CLDN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-217 aa of BC051870 Sequence: SLYLGWAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV Predict reactive species Full Name: claudin 9 Calculated Molecular Weight: 217 aa, 23 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC051870 Gene Symbol: Claudin 9 Gene ID (NCBI): 9080 RRID: AB_3086347 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95484 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.