Proteintech, 30523-1-AP, IBA1 Polyclonal antibody

Size: 20ul / 150ul The IBA1 (30523-1-AP) by Proteintech is a Polyclonal antibody targeting IBA1 in IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 30523-1-AP targets IBA1 in IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive IHC detected in: rat brain tissue, mouse brain tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30575 Product name: Recombinant mouse AIF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-147 aa of NM_019467 Sequence: LKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP Predict reactive species Full Name: allograft inflammatory factor 1 Calculated Molecular Weight: 17 kDa GenBank Accession Number: NM_019467 Gene Symbol: IBA1 Gene ID (NCBI): 11629 RRID: AB_3086348 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O70200 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.