Product Description
Size: 20ul / 150ul
The ALAS2 (30539-1-AP) by Proteintech is a Polyclonal antibody targeting ALAS2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples
30539-1-AP targets ALAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: K-562 cells, NIH/3T3 cells, mouse brain tissue, mouse heart tissue
Positive IF/ICC detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
The heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30308 Product name: Recombinant human ALAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 502-574 aa of BC030230 Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA Predict reactive species
Full Name: aminolevulinate, delta-, synthase 2
Calculated Molecular Weight: 587 aa, 65 kDa
Observed Molecular Weight: 65 kDa
GenBank Accession Number: BC030230
Gene Symbol: ALAS2
Gene ID (NCBI): 212
RRID: AB_3086355
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P22557
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924