Product Description
Size: 20ul / 150ul
The CRKL (30546-1-AP) by Proteintech is a Polyclonal antibody targeting CRKL in WB, ELISA applications with reactivity to Human samples
30546-1-AP targets CRKL in WB, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: HEK-293T cells, Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: Human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30874 Product name: Recombinant human CRKL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-242 aa of NM_005207 Sequence: LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKA Predict reactive species
Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Calculated Molecular Weight: 34 kDa
Observed Molecular Weight: 35 kDa
GenBank Accession Number: NM_005207
Gene Symbol: CRKL
Gene ID (NCBI): 1399
RRID: AB_3086359
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P46109
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924