Iright
BRAND / VENDOR: Proteintech

Proteintech, 30549-1-AP, SYN1 Polyclonal antibody

CATALOG NUMBER: 30549-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SYN1 (30549-1-AP) by Proteintech is a Polyclonal antibody targeting SYN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30549-1-AP targets SYN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: IMR-32 cells, SH-SY5Y cells, SK-N-SH cells Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SYN1, also named Synapsin I, Brain protein 4.1, belongs to the Synapsin family. SYN1 is a neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to regulate neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. Defects in SYN1 are a cause of epilepsy X-linked with variable learning disabilities and behavior disorders (XELBD). Synapsin I (SYN1) is composed of two isoforms, synapsin Ia and Ib, with molecular weights of 74 kDa and 70 kDa, respectively. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31091 Product name: Recombinant human SYN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 362-511 aa of NM_006950 Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPAGSPLPQRLPSP Predict reactive species Full Name: synapsin I Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: NM_006950 Gene Symbol: SYN1 Gene ID (NCBI): 6853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17600 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924