Product Description
Size: 20ul / 150ul
The MFSD2 (30555-1-AP) by Proteintech is a Polyclonal antibody targeting MFSD2 in WB, ELISA applications with reactivity to human, mouse, rat samples
30555-1-AP targets MFSD2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
MFSD2 is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. MFSD2 is involved in the establishment of the blood-brain barrier and is required for brain growth and function.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33064 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-219 aa of BC092414 Sequence: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Predict reactive species
Full Name: major facilitator superfamily domain containing 2
Calculated Molecular Weight: 543 aa, 60 kDa
Observed Molecular Weight: 55-60 kDa
GenBank Accession Number: BC092414
Gene Symbol: MFSD2
Gene ID (NCBI): 84879
RRID: AB_3086361
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8NA29
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924