Iright
BRAND / VENDOR: Proteintech

Proteintech, 30555-1-AP, MFSD2 Polyclonal antibody

CATALOG NUMBER: 30555-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MFSD2 (30555-1-AP) by Proteintech is a Polyclonal antibody targeting MFSD2 in WB, ELISA applications with reactivity to human, mouse, rat samples 30555-1-AP targets MFSD2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MFSD2 is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. MFSD2 is involved in the establishment of the blood-brain barrier and is required for brain growth and function. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33064 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-219 aa of BC092414 Sequence: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Predict reactive species Full Name: major facilitator superfamily domain containing 2 Calculated Molecular Weight: 543 aa, 60 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC092414 Gene Symbol: MFSD2 Gene ID (NCBI): 84879 RRID: AB_3086361 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924