Iright
BRAND / VENDOR: Proteintech

Proteintech, 30580-1-AP, PSMA5 Polyclonal antibody

CATALOG NUMBER: 30580-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSMA5 (30580-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30580-1-AP targets PSMA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HCT 116 cells, HepG2 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Proteasome subunit alpha type-5(PSMA5) is a component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. It binds to two 19S regulatory particles(RP) to form the 26S proteasome, an ATP-dependent multisubunit protease that degrades polyubiquitinated proteins into small peptides.(PMID: 26661102) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30703 Product name: Recombinant human PSMA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-241 aa of NM_002790 Sequence: ALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI Predict reactive species Full Name: proteasome (prosome, macropain) subunit, alpha type, 5 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: NM_002790 Gene Symbol: PSMA5 Gene ID (NCBI): 5686 RRID: AB_3086368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28066 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924