Iright
BRAND / VENDOR: Proteintech

Proteintech, 30599-1-AP, VCAN Polyclonal antibody

CATALOG NUMBER: 30599-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VCAN (30599-1-AP) by Proteintech is a Polyclonal antibody targeting VCAN in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30599-1-AP targets VCAN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human stomach cancer tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Versican, a component of the extracellular matrix and a member of the lectican family of proteoglycans, is the largest chondroitin sulfate proteoglycan and has an important role in the development of the heart, musculoskeletal system and central nervous system (CNS). The structure of versican is characterized by an approximately 550-kDa core protein consisting of an amino-terminal (G1) hyaluronan binding domain, a carboxy-terminal (G3) domain, and two central chondroitin sulfate glycosaminoglycan attachment domains, the α-GAG and β-GAG domains. Versican has four different isoforms that differ in the central GAG attachment domain: V0 (contains both α and β GAG domains), V1 (contains only the β domain), V2 (contains only the α domain) and V3 (devoid of both GAG domains)(PMID: 26385570). Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30151 Product name: Recombinant human VCAN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-535 aa of NM_004385 Sequence: FEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKM Predict reactive species Full Name: versican Calculated Molecular Weight: 373 kDa Observed Molecular Weight: 250-300 kDa, 550 kDa GenBank Accession Number: NM_004385 Gene Symbol: VCAN Gene ID (NCBI): 1462 RRID: AB_3669736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13611 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924