Proteintech, 30606-1-AP, OSR1 Polyclonal antibody

Size: 20ul / 150ul The OSR1 (30606-1-AP) by Proteintech is a Polyclonal antibody targeting OSR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30606-1-AP targets OSR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse embryo tissue, rat bladder tissue Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Odd-skipped-related1(OSR1), contains 3 C2H3-type zinc fingers, a tyrosine phosphorylation site and several putative PXXP SH3 binding motifs. It's a transcription factor that has a role in embryonic heart and urogenital development. Expressed during the beginning stages of embryogenesis and during limb and branchial arch development, it possibly participarts in the metanephric kidney formation. OSR1 also plays a key role in the generation of kidney precursor cells and their subsequent differentiation into nephrons. OSR1 is upregulated in several pancreatic and esopha-geal cancer cell lines and downregulated in some primary gastric cancers Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31336 Product name: Recombinant human OSR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-168 aa of BC025712 Sequence: FANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLP Predict reactive species Full Name: odd-skipped related 1 (Drosophila) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC025712 Gene Symbol: OSR1 Gene ID (NCBI): 130497 RRID: AB_3669737 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.