Iright
BRAND / VENDOR: Proteintech

Proteintech, 30607-1-AP, EYA2 Polyclonal antibody

CATALOG NUMBER: 30607-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EYA2 (30607-1-AP) by Proteintech is a Polyclonal antibody targeting EYA2 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30607-1-AP targets EYA2 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EYA2, also named EAB1, belongs to the HAD-like hydrolase superfamily and EYA family. It coactivates SIX1. The Six1-EYA2 interaction may inhibit breast cancer progression. EYA2 is required for Six1-activated TGF-beta signaling.(PMID:21706047) It may be involved in the development of the eye. This protein has 3 isoforms produced by alternative splicing with the molecular weight of 59 kDa, 57 kDa, and 50 kDa. It can be detected two bands of 70 kDa and 56 kDa in the neuroblastoma cells by western blot(PMID:12039049). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31827 Product name: Recombinant human EYA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 125-400 aa of BC013882 Sequence: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD Predict reactive species Full Name: eyes absent homolog 2 (Drosophila) Calculated Molecular Weight: 64 kDa GenBank Accession Number: BC013882 Gene Symbol: EYA2 Gene ID (NCBI): 2139 RRID: AB_3669738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00167 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924