Iright
BRAND / VENDOR: Proteintech

Proteintech, 30615-1-AP, MMP11 Polyclonal antibody

CATALOG NUMBER: 30615-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MMP11 (30615-1-AP) by Proteintech is a Polyclonal antibody targeting MMP11 in WB, IF/ICC, ELISA applications with reactivity to human samples 30615-1-AP targets MMP11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, T-47D cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Matrix metalloproteinase 11 (MMP11), also named stromelysin-3, is a member of the stromelysin subgroup belonging to MMPs superfamily. The role of MMP11 in cancer progression has been shown by several preclinical observations: its expression promotes tumor take in mice, homing of malignant epithelial cells, cancer progression by remodeling extracellular matrix, and antiapoptotic and antinecrotic effect on tumor cells (PMID: 19509157, 26892540). The immunoblot demonstrated two separate bands of ~65 kDa (latent proenzyme form) and ~45 kD (active form) of secreted MMP-11 protein (PMID: 21442356). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31191 Product name: Recombinant human MMP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-208 aa of NM_005940 Sequence: VLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTD Predict reactive species Full Name: matrix metallopeptidase 11 (stromelysin 3) Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: NM_005940 Gene Symbol: MMP11 Gene ID (NCBI): 4320 RRID: AB_3086374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24347 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924