Iright
BRAND / VENDOR: Proteintech

Proteintech, 30627-1-AP, LAPTM4A Polyclonal antibody

CATALOG NUMBER: 30627-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LAPTM4A (30627-1-AP) by Proteintech is a Polyclonal antibody targeting LAPTM4A in WB, IF-P, ELISA applications with reactivity to human, mouse samples 30627-1-AP targets LAPTM4A in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information LAPTM4A is an intracellular membrane protein that regulates the function of organic cation transporter-2 (OCT2) through direct interaction. LAPTM4A can also form a complex with A4GALT in the Golgi and shows at about 70 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6501 Product name: Recombinant human LAPTM4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC000421 Sequence: MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA Predict reactive species Full Name: lysosomal protein transmembrane 4 alpha Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC000421 Gene Symbol: LAPTM4A Gene ID (NCBI): 9741 RRID: AB_3086376 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15012 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924