Iright
BRAND / VENDOR: Proteintech

Proteintech, 30628-1-AP, NOD2 Polyclonal antibody

CATALOG NUMBER: 30628-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NOD2 (30628-1-AP) by Proteintech is a Polyclonal antibody targeting NOD2 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30628-1-AP targets NOD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NOD2, also named as CARD15 and IBD1, induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. It confers responsiveness to intracellular bacterial lipopolysaccharides (LPS). Defects in NOD2 are the cause of Blau syndrome (BS). Defects in NOD2 are a cause of susceptibility to Crohn disease (CD). Defects in NOD2 are a cause of susceptibility to ulcerative colitis. Defects in NOD2 are the cause of early-onset sarcoidosis (EOS). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33771 Product name: Recombinant human NOD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-216 aa of NM_001293557 Sequence: SQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEA* Predict reactive species Full Name: nucleotide-binding oligomerization domain containing 2 Calculated Molecular Weight: 115 kDa GenBank Accession Number: NM_001293557 Gene Symbol: NOD2 Gene ID (NCBI): 64127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924