Proteintech, 30631-1-AP, SLC25A4 Polyclonal antibody

Size: 20ul / 150ul The SLC25A4 (30631-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A4 in WB, ELISA applications with reactivity to human, mouse samples 30631-1-AP targets SLC25A4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C2C12 cells, mouse brain tissue, mouse heart tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Adenine nucleotide translocators (ANTs) are mitochondrial carrier proteins that exchange ATP and ADP between the cytoplasm and the mitochondrial matrix. Four isoforms of ANT were identified: ANT1 (encoded by SLC25A4) is highly expressed in different tissues; ANT2 (encoded by SLC25A5) is predominantly expressed in proliferating, regenerating, or undifferentiated cells; ANT3 is ubiquitously expressed; ANT4 is mainly expressed in testis and germ cells. This antibody recognizes both of ANT1 and ANT2. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33385 Product name: Recombinant human SLC25A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-178 aa of BC008664 Sequence: VYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFN Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC008664 Gene Symbol: SLC25A4 Gene ID (NCBI): 291 RRID: AB_3086377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.