Iright
BRAND / VENDOR: Proteintech

Proteintech, 30638-1-AP, SEMA3C Polyclonal antibody

CATALOG NUMBER: 30638-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SEMA3C (30638-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA3C in IHC, ELISA applications with reactivity to human, mouse samples 30638-1-AP targets SEMA3C in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SEMA3C (Semaphorin 3C) is associated with tumor progression and poor prognosis across multiple tumor types, including pancreatic, gastric, prostate, and breast cancer, as well as glioma. It is worth noting that full-length SEMA3C has also been reported as a tumor suppressor factor by suppressing tumor lymphangiogenesis and metastasis (PMID: 31649890). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32426 Product name: Recombinant human SEMA3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 560-751 aa of BC030690 Sequence: PLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES Predict reactive species Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C Calculated Molecular Weight: 85 kDa GenBank Accession Number: BC030690 Gene Symbol: SEMA3C Gene ID (NCBI): 10512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99985 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924