Iright
BRAND / VENDOR: Proteintech

Proteintech, 30640-1-AP, ZFP36L2 Polyclonal antibody

CATALOG NUMBER: 30640-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZFP36L2 (30640-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP36L2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30640-1-AP targets ZFP36L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, HepG2 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ZFP36L2 (Zinc finger protein 36 like 2) is an RNA-binding protein, belonging to the ZFP36 family, which regulates gene expression at the post-transcriptional level by binding and destabilizing certain AU-rich element (ARE) located in the 3′ untranslated regions (3′UTRs) of mRNA (PMID: 29518627). Moreover, ZFP36L2 is a key protein that controls S-phase progression in the case of genome instability (PMID: 29449217). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32428 Product name: Recombinant human ZFP36L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-482 aa of BC005010 Sequence: SCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQQQQGLAPPAQPPAPPSATLPAGAAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDP Predict reactive species Full Name: zinc finger protein 36, C3H type-like 2 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC005010 Gene Symbol: ZFP36L2 Gene ID (NCBI): 678 RRID: AB_3669744 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47974 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924