Product Description
Size: 20ul / 150ul
The MORF4L1 (30673-1-AP) by Proteintech is a Polyclonal antibody targeting MORF4L1 in WB, ELISA applications with reactivity to Human samples
30673-1-AP targets MORF4L1 in WB, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: HEK-293T cells, MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
MORF4L1, also named as MRG15, belongs to the MRG family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. It is also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. (PMID:14966270) This antibody has no cross-reaction to MORF4L2.
Specification
Tested Reactivity: Human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33839 Product name: Recombinant human MORF4L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC022845 Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKK Predict reactive species
Full Name: mortality factor 4 like 1
Calculated Molecular Weight: 362 aa, 41 kDa
Observed Molecular Weight: 38 kDa
GenBank Accession Number: BC022845
Gene Symbol: MORF4L1
Gene ID (NCBI): 10933
RRID: AB_3086384
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UBU8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924