Iright
BRAND / VENDOR: Proteintech

Proteintech, 30684-1-AP, Dnmt3c Polyclonal antibody

CATALOG NUMBER: 30684-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Dnmt3c (30684-1-AP) by Proteintech is a Polyclonal antibody targeting Dnmt3c in WB, ELISA applications with reactivity to human, mouse, rat samples 30684-1-AP targets Dnmt3c in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DNMT3C is highly specialized at methylating young retrotransposon promoters in the male germ line. In comparison, DNMT3B is not involved in germ cell development but establishes somatic methylation patterns genome-wide in the early embryo. DNMT3C has therefore evolved its own regulatory pattern and genomic targets, which have diverged from the ancestral DNMT3B copy. Despite the strict requirement of DNMT3C in the mouse, the Dnmt3C duplication is not universal among mammals but occurred ~46 million years ago in the last common ancestor of the muroid rodents. (PMID: 27856912) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33470 Product name: Recombinant mouse Dnmt3c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of Sequence: MRGGSRHLSNEEDVSGCEDCIIISGTCSDQSSDPKTVPLTQVLEAVCTVENRGCRTSSQPSKRKASSLISYVQDLTGDGDEDRDGEVGGSSGSGTPVMPQLFCETRIPSKTPAPLSWQANTSASTPWLSPASPYPIIDLTDEDVIPQSISTPSVDWSQDS Predict reactive species Full Name: predicted gene, OTTMUSG00000016816 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 70 kDa Gene Symbol: OTTMUSG00000016816 Gene ID (NCBI): 668932 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DOY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924