Product Description
Size: 20ul / 150ul
The CCDC23 (30688-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC23 in IHC, ELISA applications with reactivity to human, mouse samples
30688-1-AP targets CCDC23 in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
CCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33650 Product name: Recombinant human CCDC23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-66 aa of BC029427 Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE Predict reactive species
Full Name: coiled-coil domain containing 23
GenBank Accession Number: BC029427
Gene Symbol: CCDC23
Gene ID (NCBI): 374969
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8N300
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924